PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000744-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 174aa    MW: 18865.9 Da    PI: 8.6033
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000744-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer91.48.5e-2996151359
    ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                    +vrY+eC kNhA s+Ggh+vDGCg fmps geegt++alkCaAC+C R F R+e+e 
  NNU_000744-RA  96 SVRYRECFKNHAGSIGGHVVDGCGKFMPS-GEEGTPEALKCAACDCRRTFYRKEMEG 151
                    79**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-1996150IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.9E-2797149IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.5E-2698149IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.20299148IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MRLGTEKQFS TPSQTQTLDH LQQHHHHRPH QPQGHGRNPD PYSDPVPVTI AVSGATSAPV  60
AGGSNSARTT PPPPPLPLPP PTTATISTTT KSTATSVRYR ECFKNHAGSI GGHVVDGCGK  120
FMPSGEEGTP EALKCAACDC RRTFYRKEME GEPQSGANCY YYHNKNHDGT RQHK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254807.16e-63PREDICTED: zinc-finger homeodomain protein 5-like
RefseqXP_010254806.16e-63PREDICTED: zinc-finger homeodomain protein 5-like
RefseqXP_010254805.16e-63PREDICTED: zinc-finger homeodomain protein 5-like
TrEMBLF6GWV83e-39F6GWV8_VITVI; Putative uncharacterized protein
STRINGVIT_04s0023g01880.t019e-39(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.13e-27homeobox protein 33